G6PC Antikörper (Glucose 6-Phosphatase, Catalytic) (N-Term)

Details for Product anti-G6PC Antibody No. ABIN634831
Antigen
Epitop
N-Term
9
7
7
7
4
4
Reaktivität
Human, Hund
33
12
10
2
1
1
1
1
Wirt
Kaninchen
35
3
Klonalität
Polyklonal
Konjugat
Dieser G6PC Antikörper ist unkonjugiert
4
3
3
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
26
18
15
7
5
5
Optionen
Immunogen G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
Spezifität G6 PC antibody was raised against the N terminal of G6 C
Reinigung Affinity purified
Antigen
Andere Bezeichnung G6PC (G6PC Antibody Abstract)
Hintergrund G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
Molekulargewicht 40 kDa (MW of target protein)
Pathways Carbohydrate Homeostasis, Cellular Glucan Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Glucose 6-Phosphatase, Catalytic (G6PC) (N-Term) antibody (ABIN634831) G6PC antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magn...
Image no. 2 for anti-Glucose 6-Phosphatase, Catalytic (G6PC) (N-Term) antibody (ABIN634831) G6PC antibody used at 1 ug/ml to detect target protein.