G6PC Antikörper (N-Term)

Produktnummer ABIN634831

Produktdetails anti-G6PC Antikörper

Target: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser G6PC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: G6 PC antibody was raised against the N terminal of G6 C

Aufreinigung: Affinity purified

Immunogen: G6 PC antibody was raised using the N terminal of G6 C corresponding to a region with amino acids NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

G6PC Blocking Peptide, catalog no. 33R-6784, is also available for use as a blocking control in assays to test for specificity of this G6PC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 C antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu G6PC

Target: G6PC (Glucose 6-Phosphatase, Catalytic (G6PC))

Andere Bezeichnung: G6PC (G6PC Produkte)

Hintergrund: G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis, Cellular Glucan Metabolic Process