MCTP1 Antikörper (Middle Region)

Produktnummer ABIN634827

Dieser Anti-MCTP1 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von MCTP1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für MCTP1 Antikörper (Middle Region) (ABIN634827)

Target: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCTP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCTP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MCTP1 antibody was raised against the middle region of MCTP1

Aufreinigung: Affinity purified

Immunogen: MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids LVWGINKFTKKLRSPYAIDNNELLDFLSRVPSDVQVVQYQELKPDPSHSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MCTP1 Blocking Peptide, (ABIN5614707), is also available for use as a blocking control in assays to test for specificity of this MCTP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCTP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCTP1

Target: MCTP1 (Multiple C2 Domains, Transmembrane 1 (MCTP1))

Andere Bezeichnung: MCTP1

Hintergrund: MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.

Molekulargewicht: 89 kDa (MW of target protein)