SUN1 Antikörper

Produktnummer ABIN634826

Produktdetails anti-SUN1 Antikörper

Target: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UNC84 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC84A Blocking Peptide, catalog no. 33R-7492, is also available for use as a blocking control in assays to test for specificity of this UNC84A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUN1

Target: SUN1 (Sad1 and UNC84 Domain Containing 1 (SUN1))

Andere Bezeichnung: UNC84A (SUN1 Produkte)

Synonyme: UNC84A antikoerper, 4632417G13Rik antikoerper, 5730434D03Rik antikoerper, Unc84a antikoerper, mKIAA0810 antikoerper, Sun domain-containing protein 1 antikoerper, Sad1 and UNC84 domain containing 1 antikoerper, sun-1 antikoerper, SUN1 antikoerper, Sun1 antikoerper

Hintergrund: This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described, however, the full-length nature of some of these variants has not been determined.

Molekulargewicht: 78 kDa (MW of target protein)

Pathways: Maintenance of Protein Location