ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9) Antikörper

Details zu Produkt Nr. ABIN634823
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
57
46
45
3
3
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
43
31
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
63
39
30
30
25
2
2
2
2
1
Optionen
Immunogen ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Reinigung Affinity purified
Antigen
Andere Bezeichnung ABCC9 (ABCC9 Antibody Abstract)
Hintergrund ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.
Molekulargewicht 174 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC9 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9) antibody (ABIN634823) ABCC9 antibody used at 1 ug/ml to detect target protein.