TMEM168 Antikörper (C-Term)

Produktnummer ABIN634819

Produktdetails anti-TMEM168 Antikörper

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM168 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM168 antibody was raised against the C terminal of TMEM168

Aufreinigung: Affinity purified

Immunogen: TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM168 Blocking Peptide, catalog no. 33R-2336, is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM168

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Andere Bezeichnung: TMEM168 (TMEM168 Produkte)

Synonyme: tmem168 antikoerper, si:dkey-192l17.1 antikoerper, flj13576 antikoerper, 5730526F17Rik antikoerper, 8430437G11Rik antikoerper, AI462344 antikoerper, AI504145 antikoerper, RGD1307778 antikoerper, transmembrane protein 168 antikoerper, transmembrane protein 168a antikoerper, transmembrane protein 168 S homeolog antikoerper, TMEM168 antikoerper, tmem168a antikoerper, tmem168.S antikoerper, Tmem168 antikoerper

Hintergrund: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Molekulargewicht: 80 kDa (MW of target protein)