TMEM168 Antikörper (C-Term)

Produktnummer ABIN634819

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM168 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TMEM168 Antikörper (C-Term) (ABIN634819)

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM168 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM168 Antikörper

Bindungsspezifität: C-Term

Spezifität: TMEM168 antibody was raised against the C terminal of TMEM168

Aufreinigung: Affinity purified

Immunogen: TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM168 Blocking Peptide, (ABIN937722), is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM168 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM168

Target: TMEM168 (Transmembrane Protein 168 (TMEM168))

Andere Bezeichnung: TMEM168

Hintergrund: TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Molekulargewicht: 80 kDa (MW of target protein)