PI16 Antikörper (Middle Region)
-
- Target Alle PI16 Antikörper anzeigen
- PI16 (Peptidase Inhibitor 16 (PI16))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PI16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PI16 antibody was raised against the middle region of PI16
- Aufreinigung
- Affinity purified
- Immunogen
- PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV
- Top Product
- Discover our top product PI16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PI16 Blocking Peptide, catalog no. 33R-8568, is also available for use as a blocking control in assays to test for specificity of this PI16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PI16 (Peptidase Inhibitor 16 (PI16))
- Andere Bezeichnung
- PI16 (PI16 Produkte)
- Hintergrund
- PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.
- Molekulargewicht
- 47 kDa (MW of target protein)
-