PI16 Antikörper (Middle Region)

Produktnummer ABIN634818

Produktdetails anti-PI16 Antikörper

Target: PI16 (Peptidase Inhibitor 16 (PI16))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PI16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PI16 antibody was raised against the middle region of PI16

Aufreinigung: Affinity purified

Immunogen: PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PI16 Blocking Peptide, catalog no. 33R-8568, is also available for use as a blocking control in assays to test for specificity of this PI16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PI16

Target: PI16 (Peptidase Inhibitor 16 (PI16))

Andere Bezeichnung: PI16 (PI16 Produkte)

Hintergrund: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Molekulargewicht: 47 kDa (MW of target protein)