Peptide YY Antikörper (Middle Region)

Produktnummer ABIN634817

Der Kaninchen Polyklonal anti-Peptide YY Antikörper wird verwendet zum Nachweis von Peptide YY in Proben von Human, Ratte, Maus und Hund. Er wurde validiert für WB.

Kurzübersicht für Peptide YY Antikörper (Middle Region) (ABIN634817)

Target: Peptide YY (PYY)

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peptide YY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Peptide YY Antikörper

Bindungsspezifität: Middle Region

Spezifität: PYY antibody was raised against the middle region of PYY

Aufreinigung: Affinity purified

Immunogen: PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYY Blocking Peptide, (ABIN936822), is also available for use as a blocking control in assays to test for specificity of this PYY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peptide YY

Target: Peptide YY (PYY)

Andere Bezeichnung: PYY

Hintergrund: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.

Molekulargewicht: 11 kDa (MW of target protein)