Neuregulin 3 Antikörper (Middle Region)

Produktnummer ABIN634810

Produktdetails anti-Neuregulin 3 Antikörper

Target: Neuregulin 3 (NRG3)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuregulin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NRG3 antibody was raised against the middle region of NRG3

Aufreinigung: Affinity purified

Immunogen: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NRG3 Blocking Peptide, catalog no. 33R-9286, is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuregulin 3

Target: Neuregulin 3 (NRG3)

Andere Bezeichnung: NRG3 (NRG3 Produkte)

Synonyme: NRG3 antikoerper, HRG3 antikoerper, pro-NRG3 antikoerper, ska antikoerper, RGD1559678 antikoerper, neuregulin 3 antikoerper, pro-neuregulin-3, membrane-bound isoform antikoerper, NRG3 antikoerper, nrg3 antikoerper, LOC100478170 antikoerper, Nrg3 antikoerper

Hintergrund: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Molekulargewicht: 75 kDa (MW of target protein)

Pathways: RTK Signalweg