Neuregulin 3 Antikörper (NRG3) (Middle Region)

Details for Product anti-NRG3 Antibody No. ABIN634810
Antigen
Epitop
Middle Region
17
9
9
2
2
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
70
31
21
2
2
1
1
1
Wirt
Kaninchen
63
8
1
Klonalität
Polyklonal
Konjugat
Dieser Neuregulin 3 Antikörper ist unkonjugiert
5
4
4
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
40
36
29
13
12
2
2
1
Optionen
Immunogen NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM
Spezifität NRG3 antibody was raised against the middle region of NRG3
Reinigung Affinity purified
Antigen
Andere Bezeichnung NRG3 (NRG3 Antibody Abstract)
Hintergrund Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.
Molekulargewicht 75 kDa (MW of target protein)
Pathways RTK Signalweg
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NRG3 Blocking Peptide, catalog no. 33R-9286, is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.