Enkephalin Antikörper (Middle Region)

Produktnummer ABIN634799

Der Kaninchen Polyklonal anti-Enkephalin Antikörper wird verwendet zum Nachweis von Enkephalin in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Enkephalin Antikörper (Middle Region) (ABIN634799)

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Enkephalin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Enkephalin Antikörper

Bindungsspezifität: Middle Region

Spezifität: PENK antibody was raised against the middle region of PENK

Aufreinigung: Affinity purified

Immunogen: PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PENK Blocking Peptide, (ABIN937232), is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Enkephalin

Target: Enkephalin (PENK) (Proenkephalin (PENK))

Andere Bezeichnung: PENK

Hintergrund: Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Stem Cell Maintenance