Enkephalin Antikörper (Middle Region)
-
- Target Alle Enkephalin (PENK) Antikörper anzeigen
- Enkephalin (PENK) (Proenkephalin (PENK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Enkephalin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PENK antibody was raised against the middle region of PENK
- Aufreinigung
- Affinity purified
- Immunogen
- PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
- Top Product
- Discover our top product PENK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Enkephalin (PENK) (Proenkephalin (PENK))
- Andere Bezeichnung
- PENK (PENK Produkte)
- Hintergrund
- Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-