LEFTY1 Antikörper (N-Term)

Produktnummer ABIN634795

Produktdetails anti-LEFTY1 Antikörper

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LEFTY1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LEFTY1 antibody was raised against the N terminal of LEFTY1

Aufreinigung: Affinity purified

Immunogen: LEFTY1 antibody was raised using the N terminal of LEFTY1 corresponding to a region with amino acids MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LEFTY1 Blocking Peptide, catalog no. 33R-6338, is also available for use as a blocking control in assays to test for specificity of this LEFTY1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEFTY1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LEFTY1

Target: LEFTY1 (Left-Right Determination Factor 1 (LEFTY1))

Andere Bezeichnung: LEFTY1 (LEFTY1 Produkte)

Synonyme: atv antikoerper, cb73 antikoerper, antivin antikoerper, ik:tdsubc_2b12 antikoerper, xx:tdsubc_2b12 antikoerper, LEFTY1 antikoerper, AI450052 antikoerper, Ebaf antikoerper, Leftb antikoerper, Stra3 antikoerper, Tgfb4 antikoerper, lefty antikoerper, lefty-1 antikoerper, RGD1561867 antikoerper, LEFTB antikoerper, LEFTYB antikoerper, lefty1 antikoerper, signaling molecule lefty1 antikoerper, left-right determination factor 1 antikoerper, left right determination factor 1 antikoerper, lft1 antikoerper, lefty1 antikoerper, LOC699924 antikoerper, LEFTY1 antikoerper, LOC100408003 antikoerper, LOC100597378 antikoerper, Lefty1 antikoerper

Hintergrund: LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

Molekulargewicht: 11 kDa (MW of target protein)