GDF2 Antikörper (Middle Region)

Produktnummer ABIN634786

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GDF2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GDF2 Antikörper (Middle Region) (ABIN634786)

Target: GDF2 (Growth Differentiation Factor 2 (GDF2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GDF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GDF2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GDF2 antibody was raised against the middle region of GDF2

Aufreinigung: Affinity purified

Immunogen: GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GDF2 Blocking Peptide, (ABIN937068), is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GDF2

Target: GDF2 (Growth Differentiation Factor 2 (GDF2))

Andere Bezeichnung: GDF2

Hintergrund: GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis