PNOC Antikörper (Middle Region)

Produktnummer ABIN634785

Produktdetails anti-PNOC Antikörper

Target: PNOC (Prepronociceptin (PNOC))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNOC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNOC antibody was raised against the middle region of PNOC

Aufreinigung: Affinity purified

Immunogen: PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNOC

Target: PNOC (Prepronociceptin (PNOC))

Andere Bezeichnung: PNOC (PNOC Produkte)

Synonyme: N23K antikoerper, Npnc1 antikoerper, PPNOC antikoerper, N/OFQ antikoerper, OFQ/N antikoerper, PNOC antikoerper, OFQ antikoerper, prepronociceptin antikoerper, PNOC antikoerper, Pnoc antikoerper

Hintergrund: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Molekulargewicht: 20 kDa (MW of target protein)