Prepronociceptin (PNOC) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN634785
Antigen
Epitop
Middle Region
15
10
8
8
8
8
4
4
2
2
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
76
32
25
4
4
3
3
3
2
2
2
1
1
1
1
Wirt
Kaninchen
84
2
2
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
7
4
3
3
3
2
2
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
46
43
32
14
13
7
7
5
3
2
2
1
Optionen
Immunogen PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
Spezifität PNOC antibody was raised against the middle region of PNOC
Reinigung Affinity purified
Antigen
Andere Bezeichnung PNOC
Hintergrund Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.
Molekulargewicht 20 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Prepronociceptin (PNOC) (Middle Region) antibody (ABIN634785) PNOC antibody used at 1 ug/ml to detect target protein.