PNOC Antikörper (Middle Region)
-
- Target Alle PNOC Antikörper anzeigen
- PNOC (Prepronociceptin (PNOC))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PNOC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PNOC antibody was raised against the middle region of PNOC
- Aufreinigung
- Affinity purified
- Immunogen
- PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
- Top Product
- Discover our top product PNOC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNOC (Prepronociceptin (PNOC))
- Andere Bezeichnung
- PNOC (PNOC Produkte)
- Synonyme
- N23K antikoerper, Npnc1 antikoerper, PPNOC antikoerper, N/OFQ antikoerper, OFQ/N antikoerper, PNOC antikoerper, OFQ antikoerper, prepronociceptin antikoerper, PNOC antikoerper, Pnoc antikoerper
- Hintergrund
- Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.
- Molekulargewicht
- 20 kDa (MW of target protein)
-