PNOC Antikörper (Middle Region)

Produktnummer ABIN634785

Dieses Anti-PNOC-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PNOC in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PNOC Antikörper (Middle Region) (ABIN634785)

Target: PNOC (Prepronociceptin (PNOC))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNOC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PNOC Antikörper

Bindungsspezifität: Middle Region

Spezifität: PNOC antibody was raised against the middle region of PNOC

Aufreinigung: Affinity purified

Immunogen: PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNOC Blocking Peptide, (ABIN938046), is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNOC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNOC

Target: PNOC (Prepronociceptin (PNOC))

Andere Bezeichnung: PNOC

Hintergrund: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Molekulargewicht: 20 kDa (MW of target protein)