GMFG Antikörper (Middle Region)

Produktnummer ABIN634779

Produktdetails anti-GMFG Antikörper

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMFG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GMF gamma antibody was raised against the middle region of GMFG

Aufreinigung: Affinity purified

Immunogen: GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMF gamma Blocking Peptide, catalog no. 33R-4701, is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMFG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMFG

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Andere Bezeichnung: GMF gamma (GMFG Produkte)

Synonyme: GMF-GAMMA antikoerper, 0610039G16Rik antikoerper, 2310057N07Rik antikoerper, AI324845 antikoerper, gmf-gamma antikoerper, MGC108238 antikoerper, zgc:136987 antikoerper, glia maturation factor gamma antikoerper, glia maturation factor, gamma antikoerper, glia maturation factor, gamma S homeolog antikoerper, GMFG antikoerper, Gmfg antikoerper, gmfg.S antikoerper, gmfg antikoerper

Hintergrund: The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 17 kDa (MW of target protein)