GMFG Antikörper (Middle Region)

Produktnummer ABIN634779

Dieses Anti-GMFG-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GMFG in WB. Geeignet für Human.

Kurzübersicht für GMFG Antikörper (Middle Region) (ABIN634779)

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMFG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GMFG Antikörper

Bindungsspezifität: Middle Region

Spezifität: GMF gamma antibody was raised against the middle region of GMFG

Aufreinigung: Affinity purified

Immunogen: GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMF gamma Blocking Peptide, (ABIN940087), is also available for use as a blocking control in assays to test for specificity of this GMF gamma antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMFG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMFG

Target: GMFG (Glia Maturation Factor, gamma (GMFG))

Andere Bezeichnung: GMF gamma

Hintergrund: The function of GMF gamma protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 17 kDa (MW of target protein)