COPA Antikörper (N-Term)
-
- Target Alle COPA Antikörper anzeigen
- COPA (Coatomer Protein Complex, Subunit alpha (COPA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COPA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- COPA antibody was raised against the N terminal of COPA
- Aufreinigung
- Affinity purified
- Immunogen
- COPA antibody was raised using the N terminal of COPA corresponding to a region with amino acids PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD
- Top Product
- Discover our top product COPA Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COPA Blocking Peptide, catalog no. 33R-7432, is also available for use as a blocking control in assays to test for specificity of this COPA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COPA (Coatomer Protein Complex, Subunit alpha (COPA))
- Andere Bezeichnung
- COPA (COPA Produkte)
- Synonyme
- COPA antikoerper, DDBDRAFT_0189693 antikoerper, DDBDRAFT_0233797 antikoerper, DDB_0189693 antikoerper, DDB_0233797 antikoerper, DKFZp469O221 antikoerper, AU040324 antikoerper, xenin antikoerper, HEP-COP antikoerper, cb281 antikoerper, fb13c12 antikoerper, wu:fb13c12 antikoerper, coatomer protein complex subunit alpha antikoerper, WD40 repeat-containing protein antikoerper, Coatomer subunit alpha antikoerper, coatomer protein complex, subunit alpha antikoerper, coatomer protein complex subunit alpha L homeolog antikoerper, COPA antikoerper, copA antikoerper, cgd8_860 antikoerper, Chro.80105 antikoerper, AFUA_3G08840 antikoerper, copa antikoerper, Copa antikoerper, copa.L antikoerper
- Hintergrund
- In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone.
- Molekulargewicht
- 135 kDa (MW of target protein)
- Pathways
- Hormone Activity
-