Thrombopoietin Antikörper (THPO)

Details for Product anti-THPO Antibody No. ABIN634773
Antigen
Reaktivität
Human
125
55
21
4
2
2
1
1
1
1
1
1
Wirt
Kaninchen
105
30
28
17
Klonalität
Polyklonal
Konjugat
Dieser Thrombopoietin Antikörper ist unkonjugiert
14
8
4
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
139
112
21
18
15
11
10
8
6
5
5
2
2
2
1
1
Optionen
Immunogen Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
Reinigung Affinity purified
Antigen
Andere Bezeichnung Thrombopoietin (THPO Antibody Abstract)
Hintergrund Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.
Molekulargewicht 35 kDa (MW of target protein)
Pathways JAK-STAT Signalweg, Hormone Activity
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Thrombopoietin (THPO) antibody (ABIN634773) Thrombopoietin antibody used at 1 ug/ml to detect target protein.