Thrombopoietin Antikörper
-
- Target Alle Thrombopoietin (THPO) Antikörper anzeigen
- Thrombopoietin (THPO)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Thrombopoietin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
- Top Product
- Discover our top product THPO Primärantikörper
-
anti-Thrombopoietin (THPO) (AA 22-259) antibody
THPO Reaktivität: Ratte, Maus WB, ELISA, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) (AA 22-349) antibodyTHPO Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) antibodyTHPO Reaktivität: Human WB, ELISA, FACS Wirt: Maus Monoclonal 1B11 unconjugated
anti-Thrombopoietin (THPO) (AA 25-298) antibodyTHPO Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) (AA 21-120) antibodyTHPO Reaktivität: Human, Ratte, Maus WB, ELISA, ICC, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) (AA 307-337) antibodyTHPO Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) (AA 24-266) antibodyTHPO Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) antibodyTHPO Reaktivität: Human WB, EIA Wirt: Maus Monoclonal 1B11 unconjugated
anti-Thrombopoietin (THPO) (Internal Region) antibodyTHPO Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Thrombopoietin (THPO) (AA 22-194) antibodyTHPO Reaktivität: Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Thrombopoietin (THPO)
- Andere Bezeichnung
- Thrombopoietin (THPO Produkte)
- Synonyme
- MGDF antikoerper, MKCSF antikoerper, ML antikoerper, MPLLG antikoerper, THCYT1 antikoerper, TPO antikoerper, Mgdf antikoerper, Ml antikoerper, Mpllg antikoerper, Tpo antikoerper, Tpo1 antikoerper, Tpo2 antikoerper, Tpo3 antikoerper, Tpo4 antikoerper, tpo antikoerper, LOC100231762 antikoerper, thrombopoietin antikoerper, THPO antikoerper, Thpo antikoerper, thpo antikoerper
- Hintergrund
- Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Hormone Activity
-
