Thrombopoietin Antikörper
-
- Target Alle Thrombopoietin (THPO) Antikörper anzeigen
- Thrombopoietin (THPO)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Thrombopoietin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS
- Top Product
- Discover our top product THPO Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Thrombopoietin Blocking Peptide, catalog no. 33R-6770, is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Thrombopoietin (THPO)
- Andere Bezeichnung
- Thrombopoietin (THPO Produkte)
- Hintergrund
- Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Hormone Activity
-