LONRF2 Antikörper (Middle Region)

Produktnummer ABIN634772

Produktdetails anti-LONRF2 Antikörper

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LONRF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LONRF2 antibody was raised against the middle region of LONRF2

Aufreinigung: Affinity purified

Immunogen: LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LONRF2

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Andere Bezeichnung: LONRF2 (LONRF2 Produkte)

Synonyme: RGD1562137 antikoerper, AI851349 antikoerper, 2900060P06Rik antikoerper, LONRF2 antikoerper, RNF192 antikoerper, LON peptidase N-terminal domain and ring finger 2 antikoerper, Lonrf2 antikoerper, LONRF2 antikoerper, lonrf2 antikoerper

Hintergrund: LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.

Molekulargewicht: 84 kDa (MW of target protein)