LONRF2 Antikörper (Middle Region)

Produktnummer ABIN634772

Der Kaninchen Polyklonal Anti-LONRF2-Antikörper wurde für WB validiert. Er ist geeignet, LONRF2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für LONRF2 Antikörper (Middle Region) (ABIN634772)

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LONRF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LONRF2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LONRF2 antibody was raised against the middle region of LONRF2

Aufreinigung: Affinity purified

Immunogen: LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LONRF2 Blocking Peptide, catalog no. 33R-2908, is also available for use as a blocking control in assays to test for specificity of this LONRF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LONRF2

Target: LONRF2 (LON Peptidase N-terminal Domain and Ring Finger 2 (LONRF2))

Andere Bezeichnung: LONRF2

Hintergrund: LONRF2 contains 1 Lon domain,1 RING-type zinc finger and 6 TPR repeats. The function of the LONRF2 protein remains unknown.

Molekulargewicht: 84 kDa (MW of target protein)