-
- Target
- Glyco
- Reaktivität
- Human
- Wirt
- Kaninchen
- Klonalität
- Polyklonal
- Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Glycoprotein Ib Blocking Peptide, catalog no. 33R-7939, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein Ib antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP0 A antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glyco
- Substanzklasse
- Viral Protein
- Hintergrund
- Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.
- Molekulargewicht
- 68 kDa (MW of target protein)
-
Sie sind hier:
