Glyco Antikörper

Details zu Produkt Nr. ABIN634766
Antigen
Reaktivität
Human
1
Wirt
Kaninchen
1
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
1
Optionen
Immunogen Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Reinigung Affinity purified
Antigen
Hintergrund Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that are linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor complex includes noncovalent association of the alpha and beta subunits with platelet glycoprotein IX and platelet glycoprotein V. The binding of the GP Ib-IX-V complex to VWF facilitates initial platelet adhesion to vascular subendothelium after vascular injury, and also initiates signaling events within the platelet that lead to enhanced platelet activation, thrombosis, and hemostasis. GP1BA is the alpha subunit.
Molekulargewicht 68 kDa (MW of target protein)
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Glycoprotein Ib Blocking Peptide, catalog no. 33R-7939, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein Ib antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GP0 A antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Glyco antibody (ABIN634766) Glycoprotein Ib antibody used at 0.25 ug/ml to detect target protein.