Mesothelin Antikörper (MSLN) (Middle Region)

Details for Product anti-MSLN Antibody No. ABIN634759
Antigen
Epitop
Middle Region
16
10
7
7
5
4
4
4
4
4
4
4
4
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
147
33
9
2
2
2
2
1
1
1
Wirt
Kaninchen
115
41
7
4
1
Klonalität
Polyklonal
Konjugat
Dieser Mesothelin Antikörper ist unkonjugiert
15
9
9
3
3
3
3
3
3
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
105
71
42
21
21
13
7
7
6
5
4
4
3
2
2
2
2
1
1
Optionen
Immunogen Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF
Spezifität Mesothelin antibody was raised against the middle region of MSLN
Reinigung Affinity purified
Antigen
Andere Bezeichnung Mesothelin (MSLN Antibody Abstract)
Hintergrund An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium and mesothelioma.
Molekulargewicht 33 kDa (MW of target protein)
Pathways EGFR Signaling Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Carbohydrate Homeostasis, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Mesothelin Blocking Peptide, catalog no. 33R-5073, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSLN antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mesothelin (MSLN) (Middle Region) antibody (ABIN634759) Mesothelin antibody used at 1 ug/ml to detect target protein.