Claudin 19 Antikörper (C-Term)

Produktnummer ABIN634757

Der Kaninchen Polyklonal anti-Claudin 19 Antikörper wird verwendet zum Nachweis von Claudin 19 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Claudin 19 Antikörper (C-Term) (ABIN634757)

Target: Claudin 19 (CLDN19)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Claudin 19 Antikörper

Bindungsspezifität: C-Term

Spezifität: Claudin 19 antibody was raised against the C terminal of CLDN19

Aufreinigung: Affinity purified

Immunogen: Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 19 Blocking Peptide, (ABIN936991), is also available for use as a blocking control in assays to test for specificity of this Claudin 19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 19

Target: Claudin 19 (CLDN19)

Andere Bezeichnung: Claudin 19

Hintergrund: CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C