CDH23 Antikörper (Middle Region)

Produktnummer ABIN634752

Produktdetails anti-CDH23 Antikörper

Target: CDH23 (Cadherin 23 (CDH23))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDH23 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDH23 antibody was raised against the middle region of CDH23

Aufreinigung: Affinity purified

Immunogen: CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDH23

Target: CDH23 (Cadherin 23 (CDH23))

Andere Bezeichnung: CDH23 (CDH23 Produkte)

Hintergrund: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Sensory Perception of Sound