CDH23 Antikörper (Middle Region)
-
- Target Alle CDH23 Antikörper anzeigen
- CDH23 (Cadherin 23 (CDH23))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDH23 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDH23 antibody was raised against the middle region of CDH23
- Aufreinigung
- Affinity purified
- Immunogen
- CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
- Top Product
- Discover our top product CDH23 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDH23 (Cadherin 23 (CDH23))
- Andere Bezeichnung
- CDH23 (CDH23 Produkte)
- Synonyme
- 4930542A03Rik antikoerper, USH1D antikoerper, ahl antikoerper, ahl1 antikoerper, bob antikoerper, bus antikoerper, mdfw antikoerper, nmf112 antikoerper, nmf181 antikoerper, nmf252 antikoerper, sals antikoerper, v antikoerper, CDHR23 antikoerper, W antikoerper, cadherin 23 (otocadherin) antikoerper, cadherin related 23 antikoerper, cadherin-related 23 antikoerper, Cdh23 antikoerper, CDH23 antikoerper
- Hintergrund
- This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-