CDH23 Antikörper (Cadherin 23) (Middle Region)

Details for Product anti-CDH23 Antibody No. ABIN634752
Antigen
Epitop
Middle Region
10
7
2
1
1
1
1
1
Reaktivität
Human, Maus
75
59
51
3
3
3
3
3
1
1
1
1
1
Wirt
Kaninchen
67
7
1
Klonalität
Polyklonal
Konjugat
Dieser CDH23 Antikörper ist unkonjugiert
4
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
39
30
21
13
11
8
3
2
2
1
1
Optionen
Immunogen CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
Spezifität CDH23 antibody was raised against the middle region of CDH23
Reinigung Affinity purified
Antigen
Andere Bezeichnung CDH23 (CDH23 Antibody Abstract)
Hintergrund This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.
Molekulargewicht 56 kDa (MW of target protein)
Pathways Sensory Perception of Sound
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Cadherin 23 (CDH23) (Middle Region) antibody (ABIN634752) CDH23 antibody used at 1 ug/ml to detect target protein.