ITGB8 Antikörper (C-Term)

Produktnummer ABIN634750

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ITGB8 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ITGB8 Antikörper (C-Term) (ABIN634750)

Target: ITGB8 (Integrin beta-8 (ITGB8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGB8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ITGB8 Antikörper

Bindungsspezifität: C-Term

Spezifität: Integrin Beta 8 antibody was raised against the C terminal of ITGB8

Aufreinigung: Affinity purified

Immunogen: Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Integrin Beta 8 Blocking Peptide, (ABIN937207), is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGB8

Target: ITGB8 (Integrin beta-8 (ITGB8))

Andere Bezeichnung: Integrin beta 8

Hintergrund: ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.

Molekulargewicht: 81 kDa (MW of target protein)