TDO2 Antikörper (N-Term)
-
- Target Alle TDO2 Antikörper anzeigen
- TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TDO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TDO2 antibody was raised against the N terminal of TDO2
- Aufreinigung
- Affinity purified
- Immunogen
- TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK
- Top Product
- Discover our top product TDO2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TDO2 Blocking Peptide, catalog no. 33R-6423, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))
- Andere Bezeichnung
- TDO2 (TDO2 Produkte)
- Synonyme
- Tdo2 antikoerper, tdo2l antikoerper, fi30d08 antikoerper, zgc:63488 antikoerper, wu:fi30d08 antikoerper, TDO2 antikoerper, fb62b10 antikoerper, tdo2 antikoerper, wu:fb62b10 antikoerper, zgc:103693 antikoerper, DDBDRAFT_0190495 antikoerper, DDBDRAFT_0231363 antikoerper, DDB_0190495 antikoerper, DDB_0231363 antikoerper, TDO antikoerper, TO antikoerper, TPH2 antikoerper, TRPO antikoerper, AA407491 antikoerper, chky antikoerper, Tdo antikoerper, tryptophan 2,3-dioxygenase b antikoerper, tryptophan 2,3-dioxygenase antikoerper, tryptophan 2,3-dioxygenase a antikoerper, tryptophan 2,3-dioxygenase L homeolog antikoerper, tdo2b antikoerper, tdo2 antikoerper, TDO2 antikoerper, MADE_02822 antikoerper, CtCNB1_3657 antikoerper, tdo2a antikoerper, CNC04830 antikoerper, tdo antikoerper, Mrub_2119 antikoerper, Deipr_2235 antikoerper, Acav_1166 antikoerper, Mesop_4278 antikoerper, Tdo2 antikoerper, tdo2.L antikoerper
- Hintergrund
- Tryptophan 2,3-dioxygenase plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.
- Molekulargewicht
- 48 kDa (MW of target protein)
-