PCDHA6 Antikörper (C-Term)

Produktnummer ABIN634742

Der Kaninchen Polyklonal Anti-PCDHA6-Antikörper wurde für WB validiert. Er ist geeignet, PCDHA6 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für PCDHA6 Antikörper (C-Term) (ABIN634742)

Target: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCDHA6 Antikörper

Bindungsspezifität: C-Term

Spezifität: PCDHA6 antibody was raised against the C terminal of PCDHA6

Aufreinigung: Affinity purified

Immunogen: PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHA6 Blocking Peptide, (ABIN5615248), is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHA6

Target: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Andere Bezeichnung: PCDHA6

Hintergrund: PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 84 kDa (MW of target protein)