Neuroligin 4 Antikörper (N-Term)

Produktnummer ABIN634735

Produktdetails anti-Neuroligin 4 Antikörper

Target: Neuroligin 4 (NLGN4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuroligin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NLGN4 X antibody was raised against the N terminal of NLGN4

Aufreinigung: Affinity purified

Immunogen: NLGN4 X antibody was raised using the N terminal of NLGN4 corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NLGN4X Blocking Peptide, catalog no. 33R-8532, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuroligin 4

Target: Neuroligin 4 (NLGN4)

Andere Bezeichnung: NLGN4X (NLGN4 Produkte)

Hintergrund: NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Synaptic Membrane