GJD2 Antikörper (Middle Region)

Produktnummer ABIN634734

Produktdetails anti-GJD2 Antikörper

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJD2 antibody was raised against the middle region of GJD2

Aufreinigung: Affinity purified

Immunogen: GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJD2

Target: GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))

Andere Bezeichnung: GJD2 (GJD2 Produkte)

Synonyme: CX36 antikoerper, GJA9 antikoerper, Cx35.1 antikoerper, Cx36 antikoerper, GJD2 antikoerper, Gja9 antikoerper, connexin36 antikoerper, cx36 antikoerper, gap junction protein delta 2 antikoerper, gap junction protein, delta 2 antikoerper, GJD2 antikoerper, Gjd2 antikoerper

Hintergrund: GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

Molekulargewicht: 36 kDa (MW of target protein)