Protocadherin alpha 4 (PCDHA4) (N-Term) Antikörper

Details zu Produkt Nr. ABIN634733
Antigen
Epitop
N-Term
11
9
8
2
1
1
1
Reaktivität
Human, Ratte (Rattus)
27
4
3
3
3
3
3
2
1
1
1
1
Wirt
Kaninchen
25
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
26
16
1
1
Optionen
Immunogen PCDHA4 antibody was raised using the N terminal of PCDHA4 corresponding to a region with amino acids VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASD
Spezifität PCDHA4 antibody was raised against the N terminal of PCDHA4
Reinigung Affinity purified
Antigen
Andere Bezeichnung PCDHA4 (PCDHA4 Antibody Abstract)
Hintergrund The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.
Molekulargewicht 99 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PCDHA4 Blocking Peptide, catalog no. 33R-9478, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Protocadherin alpha 4 (PCDHA4) (N-Term) antibody (ABIN634733) PCDHA4 antibody used at 1 ug/ml to detect target protein.