PCDHA12 Antikörper (Protocadherin alpha 12) (N-Term)

Details for Product anti-PCDHA12 Antibody No. ABIN634732
Antigen
Epitop
N-Term
9
9
7
2
1
1
1
Reaktivität
Human, Ratte (Rattus)
44
7
6
2
2
2
2
1
1
1
Wirt
Kaninchen
41
3
Klonalität
Polyklonal
Konjugat
Dieser PCDHA12 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
29
21
19
13
5
Optionen
Immunogen PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG
Spezifität PCDHA12 antibody was raised against the N terminal of PCDHA12
Reinigung Affinity purified
Antigen
Andere Bezeichnung PCDHA12 (PCDHA12 Antibody Abstract)
Hintergrund PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.
Molekulargewicht 99 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PCDHA12 Blocking Peptide, catalog no. 33R-2791, is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA12 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Protocadherin alpha 12 (PCDHA12) (N-Term) antibody (ABIN634732) PCDHA12 antibody used at 1 ug/ml to detect target protein.