CNTNAP1 Antikörper (Contactin Associated Protein 1) (N-Term)

Details for Product anti-CNTNAP1 Antibody No. ABIN634731
Antigen
Epitop
N-Term
15
4
3
2
2
2
1
1
1
1
Reaktivität
Human
49
46
35
2
2
2
2
2
2
1
1
Wirt
Kaninchen
47
23
2
1
Klonalität
Polyklonal
Konjugat
Dieser CNTNAP1 Antikörper ist unkonjugiert
5
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
40
30
17
16
13
6
2
2
2
1
1
Optionen
Immunogen CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
Spezifität CNTNAP1 antibody was raised against the N terminal of CNTNAP1
Reinigung Affinity purified
Antigen
Andere Bezeichnung CNTNAP1 (CNTNAP1 Antibody Abstract)
Hintergrund CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.
Molekulargewicht 156 kDa (MW of target protein)
Pathways Cell-Cell Junction Organization
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Contactin Associated Protein 1 (CNTNAP1) (N-Term) antibody (ABIN634731) CNTNAP1 antibody used at 1 ug/ml to detect target protein.