CNTNAP1 Antikörper (N-Term)

Produktnummer ABIN634731

Produktdetails anti-CNTNAP1 Antikörper

Target: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNTNAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNTNAP1 antibody was raised against the N terminal of CNTNAP1

Aufreinigung: Affinity purified

Immunogen: CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNTNAP1 Blocking Peptide, catalog no. 33R-5315, is also available for use as a blocking control in assays to test for specificity of this CNTNAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNTNAP1

Target: CNTNAP1 (Contactin Associated Protein 1 (CNTNAP1))

Andere Bezeichnung: CNTNAP1 (CNTNAP1 Produkte)

Synonyme: CNTNAP1 antikoerper, CASPR antikoerper, CNTNAP antikoerper, NRXN4 antikoerper, P190 antikoerper, Caspr antikoerper, AI841080 antikoerper, NCP1 antikoerper, Nrxn4 antikoerper, p190 antikoerper, shm antikoerper, contactin associated protein 1 antikoerper, contactin associated protein-like 1 antikoerper, CNTNAP1 antikoerper, cntnap1 antikoerper, Cntnap1 antikoerper

Hintergrund: CNTNAP1 was initially identified as a 190 kDa protein associated with the contactin-PTPRZ1 complex. The 1,384-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain.

Molekulargewicht: 156 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization