Claudin 7 Antikörper (Middle Region)

Produktnummer ABIN634729

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Claudin 7 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Claudin 7 Antikörper (Middle Region) (ABIN634729)

Target: Claudin 7 (CLDN7)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Claudin 7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Claudin 7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Claudin 7 antibody was raised against the middle region of CLDN7

Aufreinigung: Affinity purified

Immunogen: Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin 7 Blocking Peptide, (ABIN938852), is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Claudin 7

Target: Claudin 7 (CLDN7)

Andere Bezeichnung: Claudin 7

Hintergrund: Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Hepatitis C