Claudin 7 Antikörper (Middle Region)
-
- Target Alle Claudin 7 (CLDN7) Antikörper anzeigen
- Claudin 7 (CLDN7)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Claudin 7 antibody was raised against the middle region of CLDN7
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Top Product
- Discover our top product CLDN7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 7 Blocking Peptide, catalog no. 33R-3466, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 7 (CLDN7)
- Andere Bezeichnung
- Claudin 7 (CLDN7 Produkte)
- Hintergrund
- Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-