SIGLEC10 Antikörper (Middle Region)

Produktnummer ABIN634727

Der Kaninchen Polyklonal anti-SIGLEC10 Antikörper wird verwendet zum Nachweis von SIGLEC10 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SIGLEC10 Antikörper (Middle Region) (ABIN634727)

Target: SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGLEC10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIGLEC10 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SIGLEC10 antibody was raised against the middle region of SIGLEC10

Aufreinigung: Affinity purified

Immunogen: SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGLEC10 Blocking Peptide, (ABIN937100), is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGLEC10

Target: SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))

Andere Bezeichnung: SIGLEC10

Hintergrund: SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Molekulargewicht: 76 kDa (MW of target protein)