SIGLEC7 Antikörper (Middle Region)
-
- Target Alle SIGLEC7 Antikörper anzeigen
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIGLEC7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SIGLEC7 antibody was raised against the middle region of SIGLEC7
- Aufreinigung
- Affinity purified
- Immunogen
- SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ
- Top Product
- Discover our top product SIGLEC7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SIGLEC7 Blocking Peptide, catalog no. 33R-10007, is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))
- Andere Bezeichnung
- SIGLEC7 (SIGLEC7 Produkte)
- Synonyme
- SIGLEC7 antikoerper, AIRM1 antikoerper, CD328 antikoerper, CDw328 antikoerper, D-siglec antikoerper, QA79 antikoerper, SIGLEC-7 antikoerper, SIGLEC19P antikoerper, SIGLECP2 antikoerper, p75 antikoerper, p75/AIRM1 antikoerper, sialic acid-binding Ig-like lectin 7 antikoerper, sialic acid binding Ig like lectin 7 antikoerper, LOC468976 antikoerper, SIGLEC7 antikoerper
- Hintergrund
- SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Molekulargewicht
- 51 kDa (MW of target protein)
-