SIGLEC12 Antikörper (N-Term)

Produktnummer ABIN634721

Produktdetails anti-SIGLEC12 Antikörper

Target: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGLEC12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SIGLEC12 antibody was raised against the N terminal of SIGLEC12

Aufreinigung: Affinity purified

Immunogen: SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGLEC12 Blocking Peptide, catalog no. 33R-2208, is also available for use as a blocking control in assays to test for specificity of this SIGLEC12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGLEC12

Target: SIGLEC12 (Sialic Acid Binding Ig-Like Lectin 12 (SIGLEC12))

Andere Bezeichnung: SIGLEC12 (SIGLEC12 Produkte)

Synonyme: S2V antikoerper, SIGLECL1 antikoerper, SLG antikoerper, Siglec-XII antikoerper, sialic acid binding Ig like lectin 12 (gene/pseudogene) antikoerper, sialic acid binding Ig like lectin 12 antikoerper, sialic acid binding Ig-like lectin 12 antikoerper, SIGLEC12 antikoerper

Hintergrund: Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2.

Molekulargewicht: 63 kDa (MW of target protein)