CNTNAP3 Antikörper (Middle Region)

Produktnummer ABIN634718

Produktdetails anti-CNTNAP3 Antikörper

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNTNAP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CNTNAP3 antibody was raised against the middle region of CNTNAP3

Aufreinigung: Affinity purified

Immunogen: CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNTNAP3

Target: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Andere Bezeichnung: CNTNAP3 (CNTNAP3 Produkte)

Synonyme: CNTNAP3 antikoerper, CASPR3 antikoerper, CNTNAP3A antikoerper, RP11-138L21.1 antikoerper, RP11-290L7.1 antikoerper, Cntnap3b antikoerper, LRRGT00090 antikoerper, RGD1563615 antikoerper, Cntnap3 antikoerper, contactin-associated protein-like 3 antikoerper, contactin associated protein like 3 antikoerper, contactin associated protein-like 3 antikoerper, LOC609770 antikoerper, CNTNAP3 antikoerper, LOC100439741 antikoerper, LOC100473014 antikoerper, LOC473240 antikoerper, LOC100345243 antikoerper, Cntnap3 antikoerper, LOC100725022 antikoerper

Hintergrund: The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

Molekulargewicht: 141 kDa (MW of target protein)