Claudin 11 Antikörper
-
- Target Alle Claudin 11 (CLDN11) Antikörper anzeigen
- Claudin 11 (CLDN11)
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Claudin 11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH
- Top Product
- Discover our top product CLDN11 Primärantikörper
-
anti-Claudin 11 (CLDN11) (C-Term) antibody
CLDN11 Reaktivität: Human, Maus, Ratte, Rind (Kuh) WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 188-207) antibodyCLDN11 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) antibodyCLDN11 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 101-218) antibodyCLDN11 Reaktivität: Maus, Ratte, Rind (Kuh), Schaf WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 26-207) antibodyCLDN11 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (C-Term) antibodyCLDN11 Reaktivität: Human, Ratte, Rind (Kuh), Hund, Kaninchen, Meerschweinchen, Pferd, Schwein, Affe, Fledermaus WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 23-82) antibodyCLDN11 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) antibodyCLDN11 Reaktivität: Human IF Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 1-100) antibodyCLDN11 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Claudin 11 (CLDN11) (AA 158-207) antibodyCLDN11 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Claudin 11 Blocking Peptide, catalog no. 33R-9803, is also available for use as a blocking control in assays to test for specificity of this Claudin 11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 11 (CLDN11)
- Andere Bezeichnung
- Claudin 11 (CLDN11 Produkte)
- Synonyme
- cldn11 antikoerper, fb97c11 antikoerper, wu:fb97c11 antikoerper, claudin-11 antikoerper, CLDN11 antikoerper, Claudin-11 antikoerper, DKFZp459H2322 antikoerper, OSP antikoerper, OTM antikoerper, Claudin11 antikoerper, Osp antikoerper, Otm antikoerper, claudin 11b antikoerper, claudin 11 antikoerper, cldn11b antikoerper, CLDN11 antikoerper, Cldn11 antikoerper
- Hintergrund
- CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
