SIGLEC7 Antikörper (Middle Region)

Produktnummer ABIN634715

Der Kaninchen Polyklonal Anti-SIGLEC7-Antikörper wurde für WB validiert. Er ist geeignet, SIGLEC7 in Proben von Human zu detektieren.

Kurzübersicht für SIGLEC7 Antikörper (Middle Region) (ABIN634715)

Target: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGLEC7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIGLEC7 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SIGLEC7 antibody was raised against the middle region of SIGLEC7

Aufreinigung: Affinity purified

Immunogen: SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGLEC7 Blocking Peptide, (ABIN935986), is also available for use as a blocking control in assays to test for specificity of this SIGLEC7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGLEC7

Target: SIGLEC7 (Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7))

Andere Bezeichnung: SIGLEC7

Hintergrund: SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

Molekulargewicht: 51 kDa (MW of target protein)