Cadherin 24 Antikörper (N-Term)

Produktnummer ABIN634707

Dieses Anti-Cadherin 24-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Cadherin 24 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für Cadherin 24 Antikörper (N-Term) (ABIN634707)

Target: Cadherin 24 (CDH24)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cadherin 24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cadherin 24 Antikörper

Bindungsspezifität: N-Term

Spezifität: CDH24 antibody was raised against the N terminal of CDH24

Aufreinigung: Affinity purified

Immunogen: CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH24 Blocking Peptide, (ABIN5612782), is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cadherin 24

Target: Cadherin 24 (CDH24)

Andere Bezeichnung: CDH24

Hintergrund: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.

Molekulargewicht: 88 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization