Desmocollin 3 Antikörper (N-Term)

Produktnummer ABIN634705

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Desmocollin 3 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Desmocollin 3 Antikörper (N-Term) (ABIN634705)

Target: Desmocollin 3 (DSC3)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Desmocollin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Desmocollin 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: Desmocollin 3 antibody was raised against the N terminal of DSC3

Aufreinigung: Affinity purified

Immunogen: Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Desmocollin 3 Blocking Peptide, (ABIN5613182), is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Desmocollin 3

Target: Desmocollin 3 (DSC3)

Andere Bezeichnung: Desmocollin 3

Hintergrund: DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.

Molekulargewicht: 85 kDa (MW of target protein)