Tetraspanin 2 Antikörper (Middle Region)

Produktnummer ABIN634704

Der Kaninchen Polyklonal anti-Tetraspanin 2 Antikörper (ABIN634704) detektiert spezifisch Tetraspanin 2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Tetraspanin 2 Antikörper (Middle Region) (ABIN634704)

Target: Tetraspanin 2 (TSPAN2)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tetraspanin 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Tetraspanin 2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Tetraspanin 2 antibody was raised against the middle region of TSPAN2

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 2 Blocking Peptide, (ABIN938226), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tetraspanin 2

Target: Tetraspanin 2 (TSPAN2)

Andere Bezeichnung: Tetraspanin 2

Hintergrund: TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molekulargewicht: 24 kDa (MW of target protein)