Tetraspanin 2 Antikörper (Middle Region)
-
- Target Alle Tetraspanin 2 (TSPAN2) Antikörper anzeigen
- Tetraspanin 2 (TSPAN2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tetraspanin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tetraspanin 2 antibody was raised against the middle region of TSPAN2
- Aufreinigung
- Affinity purified
- Immunogen
- Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS
- Top Product
- Discover our top product TSPAN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 2 Blocking Peptide, catalog no. 33R-2840, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tetraspanin 2 (TSPAN2)
- Andere Bezeichnung
- Tetraspanin 2 (TSPAN2 Produkte)
- Synonyme
- NET3 antikoerper, TSN2 antikoerper, TSPAN-2 antikoerper, 6330415F13Rik antikoerper, B230119D02Rik antikoerper, tspan-2 antikoerper, Tspan-2 antikoerper, tetraspanin 2 antikoerper, TSPAN2 antikoerper, tspan2 antikoerper, Tspan2 antikoerper
- Hintergrund
- TSPAN2 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Molekulargewicht
- 24 kDa (MW of target protein)
-