Cadherin 12 Antikörper

Produktnummer ABIN634703

Produktdetails anti-Cadherin 12 Antikörper

Target: Cadherin 12

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cadherin 12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDH12 Blocking Peptide, catalog no. 33R-2203, is also available for use as a blocking control in assays to test for specificity of this CDH12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cadherin 12

Target: Cadherin 12

Andere Bezeichnung: CDH12 (Cadherin 12 Produkte)

Synonyme: CDHB antikoerper, Cdhb antikoerper, RGD1566350 antikoerper, cdh12 antikoerper, cadherin 12 antikoerper, cadherin-12 antikoerper, CDH12 antikoerper, Cdh12 antikoerper, LOC570372 antikoerper

Hintergrund: CDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Molekulargewicht: 82 kDa (MW of target protein)