ADAM2 Antikörper

Produktnummer ABIN634702

Produktdetails anti-ADAM2 Antikörper

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAM2 Blocking Peptide, catalog no. 33R-7144, is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAM2

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Andere Bezeichnung: ADAM2 (ADAM2 Produkte)

Synonyme: AI323749 antikoerper, Ftnb antikoerper, Ph30-beta antikoerper, CRYN1 antikoerper, CRYN2 antikoerper, CT15 antikoerper, FTNB antikoerper, PH-30b antikoerper, PH30 antikoerper, PH30-beta antikoerper, PH-30 antikoerper, a disintegrin and metallopeptidase domain 2 antikoerper, ADAM metallopeptidase domain 2 antikoerper, Adam2 antikoerper, ADAM2 antikoerper

Hintergrund: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Molekulargewicht: 81 kDa (MW of target protein)