CSGALNACT1 Antikörper (N-Term)
Kurzübersicht für CSGALNACT1 Antikörper (N-Term) (ABIN634697)
Target
Alle CSGALNACT1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- CSGALNACT1 antibody was raised against the N terminal Of Csgalnact1
-
Aufreinigung
- Affinity purified
-
Immunogen
- CSGALNACT1 antibody was raised using the N terminal Of Csgalnact1 corresponding to a region with amino acids KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
CSGALNACT1 Blocking Peptide, (ABIN939622), is also available for use as a blocking control in assays to test for specificity of this CSGALNACT1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSGALNACT1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
-
Andere Bezeichnung
- CSGALNACT1
-
Hintergrund
- CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.
-
Molekulargewicht
- 61 kDa (MW of target protein)
-
Pathways
- Glycosaminoglycan Metabolic Process
Target
-