DLL1 Antikörper
-
- Target Alle DLL1 Antikörper anzeigen
- DLL1 (delta-Like 1 (DLL1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
- Top Product
- Discover our top product DLL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLL1 (delta-Like 1 (DLL1))
- Andere Bezeichnung
- DLL1 (DLL1 Produkte)
- Synonyme
- X-delta-1 antikoerper, XDelta1 antikoerper, Xdelta-1 antikoerper, delta antikoerper, delta-1 antikoerper, delta1 antikoerper, x-delta antikoerper, DELTA1 antikoerper, DL1 antikoerper, Delta antikoerper, DLK antikoerper, DLK-1 antikoerper, Delta1 antikoerper, FA1 antikoerper, PREF1 antikoerper, Pref-1 antikoerper, ZOG antikoerper, pG2 antikoerper, DLL1 antikoerper, AW742678 antikoerper, DlkI antikoerper, Ly107 antikoerper, Peg9 antikoerper, SCP1 antikoerper, pref-1 antikoerper, delta-like 1 antikoerper, delta like canonical Notch ligand 1 antikoerper, delta like non-canonical Notch ligand 1 antikoerper, delta-like 1 L homeolog antikoerper, delta-like 1 (Drosophila) antikoerper, delta-like 1 homolog (Drosophila) antikoerper, dll1 antikoerper, DLL1 antikoerper, DLK1 antikoerper, Dll1 antikoerper, dll1.L antikoerper, Dlk1 antikoerper
- Hintergrund
- DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.
- Molekulargewicht
- 78 kDa (MW of target protein)
- Pathways
- Notch Signalweg, Stem Cell Maintenance
-