PCDHAC1 Antikörper (N-Term)

Produktnummer ABIN634693

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PCDHAC1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für PCDHAC1 Antikörper (N-Term) (ABIN634693)

Target: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHAC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCDHAC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PCDHAC1 antibody was raised against the N terminal of PCDHAC1

Aufreinigung: Affinity purified

Immunogen: PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHAC1

Target: PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))

Andere Bezeichnung: PCDHAC1

Hintergrund: PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.

Molekulargewicht: 87 kDa (MW of target protein)