LSAMP Antikörper (N-Term)

Produktnummer ABIN634691

Der Kaninchen Polyklonal anti-LSAMP Antikörper wird verwendet zum Nachweis von LSAMP in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für LSAMP Antikörper (N-Term) (ABIN634691)

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSAMP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LSAMP Antikörper

Bindungsspezifität: N-Term

Spezifität: LSAMP antibody was raised against the N terminal of LSAMP

Aufreinigung: Affinity purified

Immunogen: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSAMP Blocking Peptide, (ABIN5614593), is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSAMP

Target: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Andere Bezeichnung: LSAMP

Hintergrund: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Molekulargewicht: 37 kDa (MW of target protein)