Protocadherin 1 Antikörper (N-Term)
-
- Target Alle Protocadherin 1 (PCDH1) Antikörper anzeigen
- Protocadherin 1 (PCDH1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Protocadherin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCDH1 antibody was raised against the N terminal of PCDH1
- Aufreinigung
- Affinity purified
- Immunogen
- PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG
- Top Product
- Discover our top product PCDH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCDH1 Blocking Peptide, catalog no. 33R-5177, is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Protocadherin 1 (PCDH1)
- Andere Bezeichnung
- PCDH1 (PCDH1 Produkte)
- Synonyme
- PC42 antikoerper, PCDH42 antikoerper, 2010005A06Rik antikoerper, AI585920 antikoerper, PCDH-1 antikoerper, axpc antikoerper, protocadherin-1 antikoerper, pcdh1 antikoerper, protocadherin 1 antikoerper, protocadherin 1 S homeolog antikoerper, protocadherin 1b antikoerper, PCDH1 antikoerper, Pcdh1 antikoerper, pcdh1.S antikoerper, pcdh1b antikoerper
- Hintergrund
- PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.
- Molekulargewicht
- 111 kDa (MW of target protein)
-